216.73.216.148
Product name Category Tier 1 (Google Product Taxonomy) Category Tier 2 (Google Product Taxonomy) Store (likely) selling the product
acrylic star earringsApparel & AccessoriesJewelryunderwayonline.com
bohemian retro long acrylic drop earrings rectangular leopard geometric earrings jewelryApparel & AccessoriesJewelrynuimun.jp
earrings mirror acrylicHome & GardenDecordaysstudies.com
hancheng fashion plated dangle hanging gem stone rhinestone long drop earrings women jewelry brincos bijouxApparel & AccessoriesJewelrywww.quailstreetdesigns.com
long crystal tassel pendant earrings rhinestone teardrop drop dangle earringsApparel & AccessoriesJewelrynuiswim.com
north star cube jewelry necklace earringsApparel & AccessoriesJewelrytvboxplug.nl
resin pendant earring women bohemia trendy geometric square acrylic drop dangle earrings women jewelryApparel & AccessoriesJewelryargentia.net
rhinestone star drop earringsApparel & AccessoriesJewelryshopccscreations.com
vintage big acrylic drop long earrings women statement elegant resin spot earrings fashion jewelry dangle brincosApparel & AccessoriesJewelryczarbrand.com
vintage fashion acrylic tassel earrings women crystal water drop earringsApparel & AccessoriesJewelrysadiescreekmarketplace.com
vintage geometric acrylic dangle hanging earring jewelryHealth & BeautyJewelry Cleaning & Carenycluxury.com
vintage multilayer crystal pendant necklace women beads moon star horn crescent choker necklaces jewelryApparel & AccessoriesJewelrysparkilylights.com






Other examples of product categorizations by users of our demo dashboard:
heart charm | 2017 domaine monthelie douhairet porcheret monthelie 1er meix bataille bourgogne | adeola bridal card | baddie oversized glasses | "basketball" premium cotton t shirt | capri pocket leggings | 7459 v neck shirttail top | 5kg digital scale kitchen food diet postal scales balance weight electronic scale weighting led electronic scale | bf6. protein power | 2020 multifunctional outdoor sport magic scarf neck warmer tube hiking cycling face head wrap cover bandana balaclava headband | "mega" ruffled sweater | bundle five | amber leather bracelet anklet | blueberry lemonade | 2021 python data business analytics | "bring friend" organic t shirt | arishine different pairs magnetic eyelashes magnetic eyeliner kit applicator | african aprons | among us bath bomb pack 6 | dark distressed denim jacket | 【rosewood】biosafe raspberry dog toy | brazilian decaf whole bean coffee | ava rabbit vibrator | long sleeve pants yoga | 2020 fashion vulcanized shoes woman outdoor lightweight casual shoes breathable lace sneakers shoes women zapatillas mujer | 9 pin male to 9 pin female cable | 2020summer sandals 2019 heel sandals slippers slip open toe sandals casual zx09821 | bamboo bowl spoon | “major payne” camo shorts | cafe royal hazelnut | "im beautiful butterfly" necklace | 490l outdoor storage box bench seat garden sheds chest | 2.5cm pearl headband vb2630 | apple watch 42mm case series 1 2 3 | bottom lashes | come away me | ascc fire hoodie | ‘luna’ casual dress | alex harry fox hoodie hoodie | autumn palms | bowtique key chain | crystal bodysuit | 10 speed vibrator kegel balls | activated charcoal cleanse detox ritual soap | boot line shoe wax polish | beautiful because | aspect deluxe wall mounted coat rack multi colour | colin robinson | checkered pocket square | amethyst citrine quartz crystal dreams necklace | dream belly plush night | gratitude sidekick journal | "game face" mens top | bath bomb lavender | ammo 2011 heavy chipping effects | aquabubbles automatic bubble gun | cienta 56000.77 mary jane | baby tie dye headband | 12" bear northern lights | ava butterfly | "miss priss" mini skirt | 225 luxe eye blender brush | all natural soy candle | abdominal muscle stimulator ems | 848 softrent hockey skate | backcamping™ portable folding stool | 10 digital download "my tears grow flowers" | beautiful ride | courtyard room whole | smile arabic . | bone candle snuffer | "fierce 2.0" ladies premium crew neck t shirt | cable beach tahitian pearl ring sterling | long weekend | 101. bomb | “sunny” lens sunglasses | peri bottle postpartum perineal care | aiyla cloud | chocolate coffee basket | ‘wtf’ long sleeve khaki | "keep calm" bath salt | caroline satin polka dot maxi skirt | 4.0mm 4.1mm. 4.2mm drill bits pearl drilling loose pearls | "alhamdullah family friends" | ausgrass turf supplies | all over custom baby one piece | auto foaming soap dispenser touch less soap dispenser | card holder wallet | barely sweet | appa acrylic figure avatar last airbender | flauntable flutter | "best cat dad ever" t shirt | autumn women ultralight thin down jacket duck down hooded jackets warm coat parka female portable outwear |