Pricing Case Study Login API
Try categorization (text)
Try categorization (image)
Try personalization
216.73.216.123

Products categorised in the past with our demo dashboard by users


Try out our product categorization solution Try out our tagging generator (on our website www.producttagging.io)

Product name Category Tier 1 (Google Product Taxonomy) Category Tier 2 (Google Product Taxonomy) Store (likely) selling the product
acrylic star earringsApparel & AccessoriesJewelryunderwayonline.com
bohemian retro long acrylic drop earrings rectangular leopard geometric earrings jewelryApparel & AccessoriesJewelrynuimun.jp
earrings mirror acrylicHome & GardenDecordaysstudies.com
hancheng fashion plated dangle hanging gem stone rhinestone long drop earrings women jewelry brincos bijouxApparel & AccessoriesJewelrywww.quailstreetdesigns.com
long crystal tassel pendant earrings rhinestone teardrop drop dangle earringsApparel & AccessoriesJewelrynuiswim.com
north star cube jewelry necklace earringsApparel & AccessoriesJewelrytvboxplug.nl
resin pendant earring women bohemia trendy geometric square acrylic drop dangle earrings women jewelryApparel & AccessoriesJewelryargentia.net
rhinestone star drop earringsApparel & AccessoriesJewelryshopccscreations.com
vintage big acrylic drop long earrings women statement elegant resin spot earrings fashion jewelry dangle brincosApparel & AccessoriesJewelryczarbrand.com
vintage fashion acrylic tassel earrings women crystal water drop earringsApparel & AccessoriesJewelrysadiescreekmarketplace.com
vintage geometric acrylic dangle hanging earring jewelryHealth & BeautyJewelry Cleaning & Carenycluxury.com
vintage multilayer crystal pendant necklace women beads moon star horn crescent choker necklaces jewelryApparel & AccessoriesJewelrysparkilylights.com






Other examples of product categorizations by users of our demo dashboard:
heart charm | 2017 domaine monthelie douhairet porcheret monthelie 1er meix bataille bourgogne | adeola bridal card | baddie oversized glasses | "basketball" premium cotton t shirt | capri pocket leggings | 7459 v neck shirttail top | 5kg digital scale kitchen food diet postal scales balance weight electronic scale weighting led electronic scale | bf6. protein power | 2020 multifunctional outdoor sport magic scarf neck warmer tube hiking cycling face head wrap cover bandana balaclava headband | "mega" ruffled sweater | bundle five | amber leather bracelet anklet | blueberry lemonade | 2021 python data business analytics | "bring friend" organic t shirt | arishine different pairs magnetic eyelashes magnetic eyeliner kit applicator | african aprons | among us bath bomb pack 6 | dark distressed denim jacket | 【rosewood】biosafe raspberry dog toy | brazilian decaf whole bean coffee | ava rabbit vibrator | long sleeve pants yoga | 2020 fashion vulcanized shoes woman outdoor lightweight casual shoes breathable lace sneakers shoes women zapatillas mujer | 9 pin male to 9 pin female cable | 2020summer sandals 2019 heel sandals slippers slip open toe sandals casual zx09821 | bamboo bowl spoon | “major payne” camo shorts | cafe royal hazelnut | "im beautiful butterfly" necklace | 490l outdoor storage box bench seat garden sheds chest | 2.5cm pearl headband vb2630 | apple watch 42mm case series 1 2 3 | bottom lashes | come away me | ascc fire hoodie | ‘luna’ casual dress | alex harry fox hoodie hoodie | autumn palms | bowtique key chain | crystal bodysuit | 10 speed vibrator kegel balls | activated charcoal cleanse detox ritual soap | boot line shoe wax polish | beautiful because | aspect deluxe wall mounted coat rack multi colour | colin robinson | checkered pocket square | amethyst citrine quartz crystal dreams necklace | dream belly plush night | gratitude sidekick journal | "game face" mens top | bath bomb lavender | ammo 2011 heavy chipping effects | aquabubbles automatic bubble gun | cienta 56000.77 mary jane | baby tie dye headband | 12" bear northern lights | ava butterfly | "miss priss" mini skirt | 225 luxe eye blender brush | all natural soy candle | abdominal muscle stimulator ems | 848 softrent hockey skate | backcamping™ portable folding stool | 10 digital download "my tears grow flowers" | beautiful ride | courtyard room whole | smile arabic . | bone candle snuffer | "fierce 2.0" ladies premium crew neck t shirt | cable beach tahitian pearl ring sterling | long weekend | 101. bomb | “sunny” lens sunglasses | peri bottle postpartum perineal care | aiyla cloud | chocolate coffee basket | ‘wtf’ long sleeve khaki | "keep calm" bath salt | caroline satin polka dot maxi skirt | 4.0mm 4.1mm. 4.2mm drill bits pearl drilling loose pearls | "alhamdullah family friends" | ausgrass turf supplies | all over custom baby one piece | auto foaming soap dispenser touch less soap dispenser | card holder wallet | barely sweet | appa acrylic figure avatar last airbender | flauntable flutter | "best cat dad ever" t shirt | autumn women ultralight thin down jacket duck down hooded jackets warm coat parka female portable outwear |
Other texts with query (demo showing only first 100 results per search, more are available with subscription)
Leading provider of product categorizations for Google Shopping, Amazon shopping, Shopify and other taxonomies. Automatically and accurately classify all types of texts into categories for easier sorting, filtering and improving discovery of your items. Assign buyer personas to your product texts and based on that provide state of the art personalized descriptions and recommendations to your customers.

Contact us: [email protected]
  • Tools & Use cases
  • Google Shopping Categorization
  • Shopify Categorization
  • Personalized Descriptions
  • Recommender demo
  • Case study - implementing all of our AI services
  • Benefits of Buyer Personas
  • Taxonomies & Our other AI platforms
  • Product categorization taxonomy
  • Buyer Personas Taxonomy
  • Website Categorization API
  • AI / LLM Visibility
  • Company
  • Alpha Quantum
  • Franz-Joseph-Str.11
  • 80801 Munich
  • Germany
  • Our website: www.alpha-quantum.com
  • Our company on Twitter
  • AISapiens.net
  • Terms of service
  • Terms of service

© 2023 | Productcategorization.com, Alpha Quantum | 2 All Rights Reserved.